PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID mrna09663.1-v1.0-hybrid
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Rosoideae; Potentilleae; Fragariinae; Fragaria
Family MYB
Protein Properties Length: 318aa    MW: 35384.5 Da    PI: 7.7149
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
mrna09663.1-v1.0-hybridgenomeGDRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding52.51.1e-161462148
                             TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
          Myb_DNA-binding  1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48
                             +g+W++eEd +l+++++++G+g +W + +++ g++R++k+c++rw++yl
  mrna09663.1-v1.0-hybrid 14 KGPWSPEEDAKLKEYIEKYGTGgNWIALPQKAGLRRCGKSCRLRWLNYL 62
                             79*********************************************97 PP

2Myb_DNA-binding41.92.4e-1369111246
                              SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
          Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                              g ++ eEd+++ ++++  G++ W+ Ia+ ++ gRt++++k++w++
  mrna09663.1-v1.0-hybrid  69 GEFSDEEDKIICNLFASIGSR-WSIIAAQLP-GRTDNDIKNYWNT 111
                              789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129422.097966IPR017930Myb domain
SuperFamilySSF466891.36E-2711109IPR009057Homeodomain-like
SMARTSM007175.5E-131364IPR001005SANT/Myb domain
PfamPF002497.3E-161462IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.9E-251569IPR009057Homeodomain-like
CDDcd001673.76E-101662No hitNo description
SMARTSM007172.5E-1267115IPR001005SANT/Myb domain
PROSITE profilePS5129417.28967117IPR017930Myb domain
PfamPF002495.9E-1269111IPR001005SANT/Myb domain
CDDcd001674.26E-970113No hitNo description
Gene3DG3DSA:1.10.10.608.7E-2470118IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Plant Ontology ? help Back to Top
PO Term PO Category PO Description
PO:0009005anatomyroot
PO:0007134developmental stagesporophyte vegetative stage
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCDKD NVKKGPWSPE EDAKLKEYIE KYGTGGNWIA LPQKAGLRRC GKSCRLRWLN  60
YLRPNIKHGE FSDEEDKIIC NLFASIGSRW SIIAAQLPGR TDNDIKNYWN TKLKKKLNQY  120
SMMGIIPHHF SSLLHPQTST SSSSPTSYRS SNNRTPSYYT HQARSFNGAN LESHIPFSPS  180
LLCCTNTTTN AALQVGQDNF VGQPMMQHYQ AKDNILMFGG TTTEASCSSS DGSYGTTGYG  240
EVQLGPQNYF YNNGAEANNQ KIMVSESGLG LDHDQARLDY GLEEIKQLIS SSTTTSGGCN  300
SFLFDENKTE EKVMMYY*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A3e-26141187109B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004304464.10.0PREDICTED: transcription factor RAX2
TrEMBLM5VQA21e-120M5VQA2_PRUPE; Uncharacterized protein
STRINGPOPTR_0006s12530.11e-108(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF13034340
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65790.15e-76myb domain protein 68